- Recombinant Mycoplasma pneumoniae Uncharacterized protein MG076 homolog (MPN_214)
- MyBioSource.com
- Pricing InfoSupplier PageView Company Product Page
- MBS1168507
- 1 mg (E Coli Derived)
- This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications
- >90%
- Recombinant Protein
- 15,773 Da
- E Coli or Yeast
- 1-138
- G07_orf138
- Uncharacterized protein MG076 homolog (MPN_214)
Sequence
MLGTQTTNSKPREYGGLIVSTIYIVLFFAILNLTVFFNKTNNINLILKNSCVVSFVVVWLLVCLQGIVRLKTCDGARYEISKFNQYLKLGSIYAKPNISFDEYKAKSSSYRKQTRGFWWMNFSLYLLGSLISIVVSLL